PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011563-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 305aa    MW: 34489.2 Da    PI: 5.4223
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011563-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
  AHYPO_011563-RA 16 RGPWSQAEDFKLISFIHKHGHNNWRALPKLAGLARCGKSCRLRWVNYL 63
                     89********************************************97 PP

2Myb_DNA-binding52.98.6e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  AHYPO_011563-RA  69 RGNFTLQEEEAIIKLHQTLGNK-WSKIASHFP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-22766IPR009057Homeodomain-like
PROSITE profilePS5129414.3441163IPR017930Myb domain
SuperFamilySSF466898.39E-3013110IPR009057Homeodomain-like
SMARTSM007172.5E-121565IPR001005SANT/Myb domain
PfamPF002491.4E-141663IPR001005SANT/Myb domain
CDDcd001678.50E-101863No hitNo description
PROSITE profilePS5129424.68364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2767118IPR009057Homeodomain-like
SMARTSM007173.2E-1568116IPR001005SANT/Myb domain
PfamPF002492.9E-1569114IPR001005SANT/Myb domain
CDDcd001673.71E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGKGRKPCCD KAGVKRGPWS QAEDFKLISF IHKHGHNNWR ALPKLAGLAR CGKSCRLRWV  60
NYLRPDLKRG NFTLQEEEAI IKLHQTLGNK WSKIASHFPG RTDNEIKNVW NTHLKKRLKV  120
KETNEKNASA SSSTCNDLAS ANTTSPNDAV LDGTNETIIN NDTIEYSSSS SSSYNSLSDQ  180
LMMTDINPSI IENIDDRNKD EMSTYPTKNI ENSLDELIEI PFEPNLDLWD LLHGDNEVQF  240
QNVDTQMCNN DKKDDNTSKE VGESWWWLVY LENELGLDHL SDGSTQLQST NVTSKNDLFS  300
YNSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010684846.11e-127PREDICTED: myb-related protein 308-like
TrEMBLA0A0J8D7271e-127A0A0J8D727_BETVU; Uncharacterized protein
STRINGVIT_19s0085g00050.t011e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.19e-78myb domain protein 58